Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LDHC protein

This Human LDHC protein spans the amino acid sequence from region 2-332aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 32 Short name, CT32 LDH testis subunit LDH-X

UniProt

P07864

Expression Region

2-332aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ras related protein Rab 11A (RAB11A) ELISA Kit
GTR10354339 96 Well

Human Ras related protein Rab 11A (RAB11A) ELISA Kit

Sign In for Pricing
View Details
TRIP6 ORF Vector (Human) (pORF)
ORF011003 1.0 µg DNA

TRIP6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human CD37 Full Length Protein, His, Flag Tag (Detergent)
CD7-H52D3-100ug 100 µg

Human CD37 Full Length Protein, His, Flag Tag (Detergent)

Sign In for Pricing
View Details
Rabbit Polyclonal UBE2T Antibody
NBP3-38343-20ul 20 µL

Rabbit Polyclonal UBE2T Antibody

Sign In for Pricing
View Details
ViPrimePLUS Anaplasma phagocytophilum qPCR Test Kit
VICA008 1 Kit

ViPrimePLUS Anaplasma phagocytophilum qPCR Test Kit

Sign In for Pricing
View Details
VPS13A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2617507 1.0 µg DNA

VPS13A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details