Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Non-specific lipid-transfer protein protein

This Plant Non-specific lipid-transfer protein protein spans the amino acid sequence from region 25-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phospholipid transfer protein Short name, PLTP

UniProt

P24296

Expression Region

25-113aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Triticum aestivum (Wheat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Adrenocorticotropic Hormone (ACTH) ELISA Kit
EKN43289 96 Tests

Mouse Adrenocorticotropic Hormone (ACTH) ELISA Kit

Sign In for Pricing
View Details
Integrin signaling Inhibitor, mP13
MBS5823715 Inquire

Integrin signaling Inhibitor, mP13

Sign In for Pricing
View Details
MIR4528 Recombinant Protein (Human)
RP073329 100 µg

MIR4528 Recombinant Protein (Human)

Sign In for Pricing
View Details
Human Rhotekin (RTKN) ELISA Kit
201-12-4803 96 Tests

Human Rhotekin (RTKN) ELISA Kit

Sign In for Pricing
View Details
OLA1 Protein Vector (Rat) (pPB-N-His)
PV286823 500 ng

OLA1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Zebrafish Alpha Parvin/Actopaxin/PARVA Rabbit Polyclonal Antibody (Fluoro550)
orb3090211 100 µg

Zebrafish Alpha Parvin/Actopaxin/PARVA Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details