Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Non-specific lipid-transfer protein protein

This Plant Non-specific lipid-transfer protein protein spans the amino acid sequence from region 25-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phospholipid transfer protein Short name, PLTP

UniProt

P24296

Expression Region

25-113aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Triticum aestivum (Wheat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT9 Double Nickase Plasmid (m)
sc-428764-NIC 20 µg

NUDT9 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Phospho-Tau-Ser404 Rabbit pAb
AP1100-01 20 µL

Phospho-Tau-Ser404 Rabbit pAb

Sign In for Pricing
View Details
Phospho-Tau-Ser404 Rabbit pAb
AP1100-02 1000 μL

Phospho-Tau-Ser404 Rabbit pAb

Sign In for Pricing
View Details
Phospho-Tau-Ser404 Rabbit pAb
AP1100-03 100 μL

Phospho-Tau-Ser404 Rabbit pAb

Sign In for Pricing
View Details
Phospho-Tau-Ser404 Rabbit pAb
AP1100-04 500 μL

Phospho-Tau-Ser404 Rabbit pAb

Sign In for Pricing
View Details
CLDN3 Antibody
orb522457-01 50 μL

CLDN3 Antibody

Sign In for Pricing
View Details