Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Non-specific lipid-transfer protein protein

This Plant Non-specific lipid-transfer protein protein spans the amino acid sequence from region 25-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phospholipid transfer protein Short name, PLTP

UniProt

P24296

Expression Region

25-113aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Triticum aestivum (Wheat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Ethynyl-2-fluoropyridine
DJB90908 2.5 g

5-Ethynyl-2-fluoropyridine

Sign In for Pricing
View Details
Lentiviral human ATP6V0D2 shRNA (UAS) - Lentiviral human ATP6V0D2 shRNA (UAS, iRFP) (100)
GTR15308838 1 Vial

Lentiviral human ATP6V0D2 shRNA (UAS) - Lentiviral human ATP6V0D2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Phospho-SRF (Ser103) Polyclonal Antibody
bs-3409R 100 µL

Phospho-SRF (Ser103) Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Complement Factor H-related 4/CFHR4 Antibody (640212) [Alexa Fluor 532]
FAB5980X 0.1 mL

Mouse Monoclonal Complement Factor H-related 4/CFHR4 Antibody (640212) [Alexa Fluor 532]

Sign In for Pricing
View Details
LUM Polyclonal Antibody
ABP59166-01 30 µL

LUM Polyclonal Antibody

Sign In for Pricing
View Details
LUM Polyclonal Antibody
ABP59166-02 100 µL

LUM Polyclonal Antibody

Sign In for Pricing
View Details