Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ERCC5 protein

This Human ERCC5 protein spans the amino acid sequence from region 947-1186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNA excision repair protein ERCC-5 Xeroderma pigmentosum group G-complementing protein

UniProt

P28715

Expression Region

947-1186aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

XCL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
50509061 1.0 µg DNA

XCL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human IgG3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61621R-BF555-01 20 µL

Human IgG3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Human IgG3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61621R-BF555-02 100 µL

Human IgG3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
CNO (Protein Cappuccino Homolog, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 4, BLOC-1 Subunit 4, BLOC1S4, FLJ11230)
125133 50 µg

CNO (Protein Cappuccino Homolog, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 4, BLOC-1 Subunit 4, BLOC1S4, FLJ11230)

Sign In for Pricing
View Details
IFN21 Polyclonal Antibody
BT-AP08775-01 20 µL

IFN21 Polyclonal Antibody

Sign In for Pricing
View Details
IFN21 Polyclonal Antibody
BT-AP08775-02 50 µL

IFN21 Polyclonal Antibody

Sign In for Pricing
View Details