Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ERCC5 protein

This Human ERCC5 protein spans the amino acid sequence from region 947-1186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNA excision repair protein ERCC-5 Xeroderma pigmentosum group G-complementing protein

UniProt

P28715

Expression Region

947-1186aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHI3L2 (NM_001025199) Human Tagged ORF Clone Lentiviral Particle
RC203807L3V 200 µL

CHI3L2 (NM_001025199) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2-Fluoro-3-nitrobenzoic Acid
TRC-F621923-5G 5 g

2-Fluoro-3-nitrobenzoic Acid

Sign In for Pricing
View Details
MKRN2 Polyclonal Antibody
E912219 100 µL

MKRN2 Polyclonal Antibody

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA, APS, Gamma Seminoprotein, hK3, Kallikrein 3, Kallikrein-3, Kallikrein-related Peptidase 3, KLK3, KLK2A1, P-30 Antigen, Semenogelase, Seminin) discontinued
P9054-08M 1 mg

Prostate Specific Antigen (PSA, APS, Gamma Seminoprotein, hK3, Kallikrein 3, Kallikrein-3, Kallikrein-related Peptidase 3, KLK3, KLK2A1, P-30 Antigen, Semenogelase, Seminin) discontinued

Sign In for Pricing
View Details
SLC6A11 siRNA (Rat)
CRR2169-01 15 nmol

SLC6A11 siRNA (Rat)

Sign In for Pricing
View Details
SLC6A11 siRNA (Rat)
CRR2169-02 30 nmol

SLC6A11 siRNA (Rat)

Sign In for Pricing
View Details