Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ERCC5 protein

This Human ERCC5 protein spans the amino acid sequence from region 947-1186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNA excision repair protein ERCC-5 Xeroderma pigmentosum group G-complementing protein

UniProt

P28715

Expression Region

947-1186aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOA (Ras Homolog Gene Family, Member A) BioAssayTM ELISA Kit (Mouse) discontinued
384262 96 Tests

RHOA (Ras Homolog Gene Family, Member A) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Rat Epididymis, Cauda Frozen Sections
RF-405 10 Slides

Rat Epididymis, Cauda Frozen Sections

Sign In for Pricing
View Details
CPUL1
MBS5815664 Inquire

CPUL1

Sign In for Pricing
View Details
FAM80A (RIMKLA) (NM_173642) Human Tagged ORF Clone
RC207938 10 µg

FAM80A (RIMKLA) (NM_173642) Human Tagged ORF Clone

Sign In for Pricing
View Details
RGAG1-set siRNA/shRNA/RNAi Lentivector (Human)
38892091 4x 500 ng

RGAG1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Mouse Ncam1 Pre-designed siRNA Set B
SI109114B 1 Each

Mouse Ncam1 Pre-designed siRNA Set B

Sign In for Pricing
View Details