Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Profilin protein

This Plant Profilin protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pollen allergen Mer a 1 Allergen, Mer a 1

UniProt

O49894

Expression Region

1-133aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Annual mercury

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EcoRV, 1000U
RE1262 1000 U

EcoRV, 1000U

Sign In for Pricing
View Details
Human P2X3 (P2RX3) activation kit by CRISPRa
GA103353 1 Kit

Human P2X3 (P2RX3) activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Mouse MHC Class I (A4C8.1-Do9) In Vivo Antibody - Low Endotoxin
ICH1097-5mg 5 mg

Anti-Mouse MHC Class I (A4C8.1-Do9) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
RNF113B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]
TA504119BM 100 µL

RNF113B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]

Sign In for Pricing
View Details
Cube Ice Maker BICU-112
BICU-112 Each

Cube Ice Maker BICU-112

Sign In for Pricing
View Details
CACNG4 Rabbit Polyclonal Antibody
AP05143PU-N 100 µg

CACNG4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details