Plant Profilin protein
This Plant Profilin protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Pollen allergen Mer a 1 Allergen, Mer a 1
UniProt
O49894
Expression Region
1-133aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Annual mercury
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PISD Mouse Monoclonal Antibody [Clone ID: OTI4G5]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90806d/imageurl/cf807336.webp)
![AF/LE Purified Anti-Mouse CD127/IL-7RA Antibody[A7R34]](https://cdn.genprice.uk/products/763/68dd14c4061270361e7d7090/imageurl/e-ab-f10230.webp)
E-AB-F10230-01 100 µg
AF/LE Purified Anti-Mouse CD127/IL-7RA Antibody[A7R34]
Sign In for Pricing
View Details E-AB-F10230-02 1 mg
AF/LE Purified Anti-Mouse CD127/IL-7RA Antibody[A7R34]
Sign In for Pricing
View Details E-AB-F10230-03 5 mg
AF/LE Purified Anti-Mouse CD127/IL-7RA Antibody[A7R34]
Sign In for Pricing
View Details E-AB-F10230-04 25 mg
AF/LE Purified Anti-Mouse CD127/IL-7RA Antibody[A7R34]
Sign In for Pricing
View Details E-AB-F10230-05 50 mg
AF/LE Purified Anti-Mouse CD127/IL-7RA Antibody[A7R34]
Sign In for Pricing
View Details