What is the catalog number for Human CD8A protein?

The catalog number for Human CD8A protein is orb358796.

What sizes are available for Human CD8A protein?

Human CD8A protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human CD8A protein come in?

Human CD8A protein is available in 3 different pack sizes.

Is Human CD8A protein in stock?

Human CD8A protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human CD8A protein

This Human CD8A protein spans the amino acid sequence from region 22-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen, CD8a

UniProt

P01732

Expression Region

22-182aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD