Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cbs protein

This Mouse Cbs protein spans the amino acid sequence from region 2-561aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-thionase Serine sulfhydrase

UniProt

Q91WT9

Expression Region

2-561aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr827 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4306604 1.0 µg DNA

Olfr827 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GPR133 sgRNA CRISPR Lentivector (Human) (Target 2)
K0896603 1.0 µg DNA

GPR133 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)
MBS2055231-01 0.1 mL

APC-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)
MBS2055231-02 0.2 mL

APC-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)
MBS2055231-03 0.5 mL

APC-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)
MBS2055231-04 1 mL

APC-Linked Polyclonal Antibody to Ribonuclease Inhibitor (RI)

Sign In for Pricing
View Details