Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant ypr-10 protein

This Plant ypr-10 protein spans the amino acid sequence from region 1-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

D1YSM5

Expression Region

1-157aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Actinidia deliciosa (Kiwi)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CNKSR3 activation kit by CRISPRa
GA115881 1 Kit

Human CNKSR3 activation kit by CRISPRa

Sign In for Pricing
View Details
Ethyl 2,5-dibromo-1,3-oxazole-4-carboxylate
TRC-E915705-50MG 50 mg

Ethyl 2,5-dibromo-1,3-oxazole-4-carboxylate

Sign In for Pricing
View Details
HRH2 Rabbit Polyclonal Antibody
TA377220 100 µL

HRH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human NLRP3 Recombinant Rabbit monoclonal Antibody
HA723276 100 µL

Human NLRP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707825 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Rifampicin
TRC-R508000-250MG 250 mg

Rifampicin

Sign In for Pricing
View Details