Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant ypr-10 protein

This Plant ypr-10 protein spans the amino acid sequence from region 1-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

D1YSM5

Expression Region

1-157aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Actinidia deliciosa (Kiwi)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DNA Polymerase beta Antibody
RC-16911-01 50 μL

Recombinant DNA Polymerase beta Antibody

Sign In for Pricing
View Details
Recombinant DNA Polymerase beta Antibody
RC-16911-02 100 µL

Recombinant DNA Polymerase beta Antibody

Sign In for Pricing
View Details
Recombinant DNA Polymerase beta Antibody
RC-16911-03 1 mL

Recombinant DNA Polymerase beta Antibody

Sign In for Pricing
View Details
AREL1 Antibody
KC-2345-01 50 μL

AREL1 Antibody

Sign In for Pricing
View Details
AREL1 Antibody
KC-2345-02 100 µL

AREL1 Antibody

Sign In for Pricing
View Details
AREL1 Antibody
KC-2345-03 1 mL

AREL1 Antibody

Sign In for Pricing
View Details