Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Fabp3 protein

This Rat Fabp3 protein spans the amino acid sequence from region 2-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name, H-FABP

UniProt

P07483

Expression Region

2-133aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YJR030C Antibody
orb850910 2 mg

YJR030C Antibody

Sign In for Pricing
View Details
Aristolactam AIIIa
orb1685082 25 mg

Aristolactam AIIIa

Sign In for Pricing
View Details
RASSF2 Polyclonal Antibody
MBS2573968-01 0.06 mL

RASSF2 Polyclonal Antibody

Sign In for Pricing
View Details
RASSF2 Polyclonal Antibody
MBS2573968-02 0.12 mL

RASSF2 Polyclonal Antibody

Sign In for Pricing
View Details
RASSF2 Polyclonal Antibody
MBS2573968-03 0.2 mL

RASSF2 Polyclonal Antibody

Sign In for Pricing
View Details
RASSF2 Polyclonal Antibody
MBS2573968-04 5x 0.2 mL

RASSF2 Polyclonal Antibody

Sign In for Pricing
View Details