Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TSLP protein

This Human TSLP protein spans the amino acid sequence from region 29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymic stromal lymphopoietin, Thymic stromal lymphopoietin protein TSLP, Tslp, TSLP protein, TSLP_HUMAN

UniProt

Q969D9

Expression Region

29-159aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-miR-222-5p-Off Virus
mh5357 1.0 mL

AdmiRa-hsa-miR-222-5p-Off Virus

Sign In for Pricing
View Details
INI-4001
HY-164485 1 Each

INI-4001

Sign In for Pricing
View Details
hsa-miR-6857-3p Primers
MPH03742 150 µL / 10 µM

hsa-miR-6857-3p Primers

Sign In for Pricing
View Details
Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit
E-EL-H0090-01 24 Tests

Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit

Sign In for Pricing
View Details
Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit
E-EL-H0090-02 48 Tests

Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit

Sign In for Pricing
View Details
Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit
E-EL-H0090-03 96 Tests

Human IL-1R2 (Interleukin 1 Receptor Type II) ELISA Kit

Sign In for Pricing
View Details