Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Beta-lytic metalloendopeptidase protein

This Bacterial Beta-lytic metalloendopeptidase protein spans the amino acid sequence from region 1-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-lytic protease

UniProt

P00801

Expression Region

1-178aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Lysobacter enzymogenes

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPNGLLQFPFPRGASWHVGGAHTNTGSGNYPMSSLDMSRGGGSNQNGNWVSASAAGGSFKRHSSCFAEIVHTGGWSTTYYHLMNIQYNTGANVSMNTAIANAPNTQAQALCNGGQSTGPHQHWSLKQNGSFYHLNGTYLSGYRITATGSSYDTNCSRFYLTKNGQNYCYGYYVNPGPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR339 Rat MicroRNA Expression Plasmid (MI0000620)
SC403302 10 µg

MIR339 Rat MicroRNA Expression Plasmid (MI0000620)

Sign In for Pricing
View Details
hsa-miR-208a-3p miRNA Inhibitor
MBS8292850-01 10 nmol

hsa-miR-208a-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-208a-3p miRNA Inhibitor
MBS8292850-02 20 nmol

hsa-miR-208a-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-208a-3p miRNA Inhibitor
MBS8292850-03 5x 20 nmol

hsa-miR-208a-3p miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Human LILRA3 (C-Fc)
32-11153-50 50 µg

Recombinant Human LILRA3 (C-Fc)

Sign In for Pricing
View Details
Triticum vulgaris (WGA) (MagneZoomTM)
518821-01 1 mL

Triticum vulgaris (WGA) (MagneZoomTM)

Sign In for Pricing
View Details