What is the catalog number for Viral HBV-D protein?

The catalog number for Viral HBV-D protein is orb358768.

What sizes are available for Viral HBV-D protein?

Viral HBV-D protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Viral HBV-D protein come in?

Viral HBV-D protein is available in 3 different pack sizes.

Is Viral HBV-D protein in stock?

Viral HBV-D protein is currently made to order / not held in immediate stock. Contact us for lead time.

Viral HBV-D protein

This Viral HBV-D protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBx Peptide X pX

UniProt

P03165

Expression Region

1-154aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA