Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral VACWR034 protein

This Viral VACWR034 protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein K2

UniProt

P18378

Expression Region

1-88aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NeuN Antibody [SR45-07]
ET1602-12TR 20 µL

Anti-NeuN Antibody [SR45-07]

Sign In for Pricing
View Details
VGLL2 Human qPCR Primer Pair (NM_153453)
HP218155 200 Reactions

VGLL2 Human qPCR Primer Pair (NM_153453)

Sign In for Pricing
View Details
D19Ertd652e Mouse Gene Knockout Kit (CRISPR)
KN519400 1 Kit

D19Ertd652e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]
E-AB-F1122UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]
E-AB-F1122UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD45.2 Antibody[104.2]

Sign In for Pricing
View Details
Piperazine Dihydrochloride
TRC-P480100-5G 5 g

Piperazine Dihydrochloride

Sign In for Pricing
View Details