Viral VACWR034 protein
This Viral VACWR034 protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein K2
UniProt
P18378
Expression Region
1-88aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
12.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC400984 20 µg
Kallikrein 10 (KLK10) (NM_002776) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC881481-100 1x 100 µL
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13G9]](https://cdn.genprice.uk/products/937/6868c319994c49e6dc3eecba/imageurl/ta500646am.webp)
TA500646AM 100 µL
CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13G9]
Sign In for Pricing
View Details 
TRC-O235995-50MG 50 mg
(2S,3aR,7aS)-Octahydroindole-2-carboxylic Acid (~90%, contains cis)
Sign In for Pricing
View Details 
#92271 1 Kit
Mix-n-StainTM CF®405S Antibody Labeling Kit, 1x (5-20ug) labeling
Sign In for Pricing
View Details 