Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial fbpC protein

This Bacterial fbpC protein spans the amino acid sequence from region 46-340aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acyl-CoA, diacylglycerol acyltransferase Antigen 85 complex C Short name, 85C Short name, Ag85C Fibronectin-binding protein C Short name, Fbps C

UniProt

P9WQN8

Expression Region

46-340aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC26A10 CRISPRa sgRNA lentivector (set of three targets)(Human)
44065121 3x 1.0µg DNA

SLC26A10 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mouse Monoclonal VEGF Antibody (VG1) [DyLight 405]
NB100-664V 0.1 mL

Mouse Monoclonal VEGF Antibody (VG1) [DyLight 405]

Sign In for Pricing
View Details
Recombinant Mouse VPS26B Protein, His (Fc)-Avi-tagged
VPS26B-10062M 50 µg

Recombinant Mouse VPS26B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PECR CRISPR Knock Out 293T Cell Line (Human)
36372141 1x 10^6 Cells / 1.0 mL

PECR CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human Salusin-α ELISA Kit
GA-E1285HM-01 48 Tests

Human Salusin-α ELISA Kit

Sign In for Pricing
View Details
Human Salusin-α ELISA Kit
GA-E1285HM-02 96 Tests

Human Salusin-α ELISA Kit

Sign In for Pricing
View Details