Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial fbpC protein

This Bacterial fbpC protein spans the amino acid sequence from region 46-340aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acyl-CoA, diacylglycerol acyltransferase Antigen 85 complex C Short name, 85C Short name, Ag85C Fibronectin-binding protein C Short name, Fbps C

UniProt

P9WQN8

Expression Region

46-340aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTS2 Antibody
OACA07068-50UL 50 µL

UTS2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to ZFP42
MBS8527797-01 0.1 mL

Mouse Monoclonal Antibody to ZFP42

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to ZFP42
MBS8527797-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to ZFP42

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to ZFP42
MBS8527797-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to ZFP42

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to ZFP42
MBS8527797-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to ZFP42

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to ZFP42
MBS8527797-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to ZFP42

Sign In for Pricing
View Details