Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Rubredoxin protein

This Bacterial Rubredoxin protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, Rd

UniProt

P00268

Expression Region

1-54aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Clostridium pasteurianum

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TULP1 3'UTR GFP Stable Cell Line
TU077546 1.0 mL

TULP1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Sennoside A
sc-258153A 50 mg

Sennoside A

Sign In for Pricing
View Details
Tex38 (NM_001109566) Rat Untagged Clone
RN211812 10 µg

Tex38 (NM_001109566) Rat Untagged Clone

Sign In for Pricing
View Details
Purified Anti-human CD5 Antibody *HISM2*
10050000-AAT 100 µg

Purified Anti-human CD5 Antibody *HISM2*

Sign In for Pricing
View Details
PYCRL Protein Vector (Human) (pPB-C-His)
PV033809 500 ng

PYCRL Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Prepro-Urotensin II (21-40) (Human) - FITC Labeled Purified IgG
FG-G-071-24B 100 µL

Prepro-Urotensin II (21-40) (Human) - FITC Labeled Purified IgG

Sign In for Pricing
View Details