Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Rubredoxin protein

This Bacterial Rubredoxin protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, Rd

UniProt

P00268

Expression Region

1-54aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Clostridium pasteurianum

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2A2 Rabbit Polyclonal Antibody (Biotin)
orb2818306 100 µg

GTF2A2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
HSP90B1, ID (HSP90B1, GRP94, TRA1, Endoplasmin, 94kD glucose-regulated protein, Heat shock protein 90kD beta member 1, Tumor rejection antigen 1, gp96 homolog) (AP) discontinued
036795-AP 200 µL

HSP90B1, ID (HSP90B1, GRP94, TRA1, Endoplasmin, 94kD glucose-regulated protein, Heat shock protein 90kD beta member 1, Tumor rejection antigen 1, gp96 homolog) (AP) discontinued

Sign In for Pricing
View Details
Rabbit TNF-alpha ELISA Kit
K0333063 96 Well

Rabbit TNF-alpha ELISA Kit

Sign In for Pricing
View Details
CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (APC)
244207-APC 100 µL

CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (APC)

Sign In for Pricing
View Details
Goat Endothelial Selectin ELISA Kit
MBS735098-01 48 Well

Goat Endothelial Selectin ELISA Kit

Sign In for Pricing
View Details
Goat Endothelial Selectin ELISA Kit
MBS735098-02 96 Well

Goat Endothelial Selectin ELISA Kit

Sign In for Pricing
View Details