Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi CDH-1 protein

This Fungi CDH-1 protein spans the amino acid sequence from region 19-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cellobiose-quinone oxidoreductase

UniProt

Q01738

Expression Region

19-208aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNCX (NM_001080461) Human Over-expression Lysate
LY420719 100 µg

UNCX (NM_001080461) Human Over-expression Lysate

Sign In for Pricing
View Details
Imidazol-1-yl-acetic Acid
TRC-I385600-1G 1 g

Imidazol-1-yl-acetic Acid

Sign In for Pricing
View Details
CD42a Recombinant Mouse Monoclonal Antibody [A5E6-R]
HA601262 100 µL

CD42a Recombinant Mouse Monoclonal Antibody [A5E6-R]

Sign In for Pricing
View Details
L-Lactic Acid (LA) Colorimetric Assay Kit
E-BC-K044-S-01 50 Assays (48 samples)

L-Lactic Acid (LA) Colorimetric Assay Kit

Sign In for Pricing
View Details
L-Lactic Acid (LA) Colorimetric Assay Kit
E-BC-K044-S-02 100 Assays (96 samples)

L-Lactic Acid (LA) Colorimetric Assay Kit

Sign In for Pricing
View Details
AP1B1 Polyclonal Antibody
E-AB-12971-01 20 µL

AP1B1 Polyclonal Antibody

Sign In for Pricing
View Details