Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi CDH-1 protein

This Fungi CDH-1 protein spans the amino acid sequence from region 19-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cellobiose-quinone oxidoreductase

UniProt

Q01738

Expression Region

19-208aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EST3 rabbit pAb
E44H12119 100 µL

EST3 rabbit pAb

Sign In for Pricing
View Details
Human Extracellular superoxide dismutase (SOD3) Elisa Kit
EK710190 96 Well

Human Extracellular superoxide dismutase (SOD3) Elisa Kit

Sign In for Pricing
View Details
Human ASIC4 knockdown cell line
ABC-KD1084 1 Vial

Human ASIC4 knockdown cell line

Sign In for Pricing
View Details
FAIM2 Antibody
MBS7125576-01 0.05 mL

FAIM2 Antibody

Sign In for Pricing
View Details
FAIM2 Antibody
MBS7125576-02 0.1 mL

FAIM2 Antibody

Sign In for Pricing
View Details
FAIM2 Antibody
MBS7125576-03 5x 0.1 mL

FAIM2 Antibody

Sign In for Pricing
View Details