What is the catalog number for Fungi CDH-1 protein?

The catalog number for Fungi CDH-1 protein is orb358757.

What sizes are available for Fungi CDH-1 protein?

Fungi CDH-1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Fungi CDH-1 protein come in?

Fungi CDH-1 protein is available in 3 different pack sizes.

Is Fungi CDH-1 protein in stock?

Fungi CDH-1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Fungi CDH-1 protein

This Fungi CDH-1 protein spans the amino acid sequence from region 19-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cellobiose-quinone oxidoreductase

UniProt

Q01738

Expression Region

19-208aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG