Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi CDH-1 protein

This Fungi CDH-1 protein spans the amino acid sequence from region 19-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cellobiose-quinone oxidoreductase

UniProt

Q01738

Expression Region

19-208aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNB1IP1 (NM_182849) Human Tagged ORF Clone
RG213849 10 µg

CCNB1IP1 (NM_182849) Human Tagged ORF Clone

Sign In for Pricing
View Details
Guinea pig Fatty acid-binding protein 9 (FABP9) ELISA Kit
EIA07900Gu 1 Kit

Guinea pig Fatty acid-binding protein 9 (FABP9) ELISA Kit

Sign In for Pricing
View Details
MOSC2 (MARC2) (NM_017898) Human Recombinant Protein
E45H40112M5 20 µg

MOSC2 (MARC2) (NM_017898) Human Recombinant Protein

Sign In for Pricing
View Details
NPY5R Polyclonal Antibody, Cy7 Conjugated
bs-11521R-Cy7 100 µL

NPY5R Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
RGS4 Rabbit Polyclonal Antibody (PE)
orb498004 100 µL

RGS4 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mad2 (C-3) P
sc-365813 P 100 µg - 0.5 mL

Mad2 (C-3) P

Sign In for Pricing
View Details