What is the catalog number for Bacterial pat protein?

The catalog number for Bacterial pat protein is orb358755.

What sizes are available for Bacterial pat protein?

Bacterial pat protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial pat protein come in?

Bacterial pat protein is available in 3 different pack sizes.

Is Bacterial pat protein in stock?

Bacterial pat protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial pat protein

This Bacterial pat protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphinothricin-resistance protein

UniProt

Q57146

Expression Region

1-183aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Streptomyces viridochromogenes

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI