Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial pat protein

This Bacterial pat protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphinothricin-resistance protein

UniProt

Q57146

Expression Region

1-183aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Streptomyces viridochromogenes

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diisobutyl Phthalate-d4
TRC-D455212-10MG 10 mg

Diisobutyl Phthalate-d4

Sign In for Pricing
View Details
EGR2 Rabbit Polyclonal Antibody (RBITC)
orb1037158 100 µL

EGR2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
PHTPP 100mg
A17035-100 100 mg

PHTPP 100mg

Sign In for Pricing
View Details
TXN Antibody
MBS7128255-01 0.05 mL

TXN Antibody

Sign In for Pricing
View Details
TXN Antibody
MBS7128255-02 0.1 mL

TXN Antibody

Sign In for Pricing
View Details
TXN Antibody
MBS7128255-03 5x 0.1 mL

TXN Antibody

Sign In for Pricing
View Details