Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HCRTR2 protein

This Human HCRTR2 protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypocretin receptor type 2

UniProt

O43614

Expression Region

1-75aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Luciferase Expressing Human Lymphatic Endothelial Cells
ABC-TC107D 1 Vial

Luciferase Expressing Human Lymphatic Endothelial Cells

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis era Protein (aa 1-300) (strain BCG / Pasteur 1173P2)
VAng-Yyj2954-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Bovis era Protein (aa 1-300) (strain BCG / Pasteur 1173P2)

Sign In for Pricing
View Details
Tank 3'UTR Luciferase Stable Cell Line
TU221567 1.0 mL

Tank 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Porcine Complement Component 5b (C5b) ELISA Kit
MBS263876-01 48 Well

Porcine Complement Component 5b (C5b) ELISA Kit

Sign In for Pricing
View Details
Porcine Complement Component 5b (C5b) ELISA Kit
MBS263876-02 96 Well

Porcine Complement Component 5b (C5b) ELISA Kit

Sign In for Pricing
View Details
Porcine Complement Component 5b (C5b) ELISA Kit
MBS263876-03 5x 96 Well

Porcine Complement Component 5b (C5b) ELISA Kit

Sign In for Pricing
View Details