Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HCRTR2 protein

This Human HCRTR2 protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypocretin receptor type 2

UniProt

O43614

Expression Region

1-75aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp5c Mouse shRNA Plasmid (Locus ID 19060)
TR510215 1 Kit

Ppp5c Mouse shRNA Plasmid (Locus ID 19060)

Sign In for Pricing
View Details
CLEC9A Peptide
DF14084-BP 1 mg

CLEC9A Peptide

Sign In for Pricing
View Details
Recombinant ASFV BA71V-003 Protein (aa 1-360)
VAng-1963Lsx-500g 500 µg

Recombinant ASFV BA71V-003 Protein (aa 1-360)

Sign In for Pricing
View Details
Rcc1 (NM_133878) Mouse Recombinant Protein
E45M46486M5 20 µg

Rcc1 (NM_133878) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human CAB39 Pre-designed siRNA Set A
SI002048A 1 Each

Human CAB39 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Glypican 2 (GPC2) (NM_152742) Human Over-expression Lysate
E45H14719-2 20 µg

Glypican 2 (GPC2) (NM_152742) Human Over-expression Lysate

Sign In for Pricing
View Details