Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUBB4A protein

This Human TUBB4A protein spans the amino acid sequence from region 1-444aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tubulin 5 beta Tubulin beta-4 chain

UniProt

P04350

Expression Region

1-444aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AADAC Polyclonal Antibody
E-AB-10690-01 20 µL

AADAC Polyclonal Antibody

Sign In for Pricing
View Details
AADAC Polyclonal Antibody
E-AB-10690-02 60 µL

AADAC Polyclonal Antibody

Sign In for Pricing
View Details
AADAC Polyclonal Antibody
E-AB-10690-03 120 µL

AADAC Polyclonal Antibody

Sign In for Pricing
View Details
AADAC Polyclonal Antibody
E-AB-10690-04 200 µL

AADAC Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant DGKA Monoclonal Antibody
E-AB-81551-01 50 µL

Recombinant DGKA Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant DGKA Monoclonal Antibody
E-AB-81551-02 100 µL

Recombinant DGKA Monoclonal Antibody

Sign In for Pricing
View Details