Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUBB4A protein

This Human TUBB4A protein spans the amino acid sequence from region 1-444aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tubulin 5 beta Tubulin beta-4 chain

UniProt

P04350

Expression Region

1-444aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAT2B (NM_013283) Human Over-expression Lysate
LC402239 20 µg

MAT2B (NM_013283) Human Over-expression Lysate

Sign In for Pricing
View Details
Des[N-[(1S)-1-[2-(cyclopropylamino)-2-oxoacetyl]butyl]carboxamido] 1-Carboxy Telaprevir
TRC-D288915-5MG 5 mg

Des[N-[(1S)-1-[2-(cyclopropylamino)-2-oxoacetyl]butyl]carboxamido] 1-Carboxy Telaprevir

Sign In for Pricing
View Details
3-Hydroxymorphinan-17-yl]-2-phenyl-ethanone
TRC-H784690-2.5MG 2.5 mg

3-Hydroxymorphinan-17-yl]-2-phenyl-ethanone

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS632412 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Nesfatin-1/Nucleobindin-2 Polyclonal Antibody
AN005880L-01 25 µL

Nesfatin-1/Nucleobindin-2 Polyclonal Antibody

Sign In for Pricing
View Details
Nesfatin-1/Nucleobindin-2 Polyclonal Antibody
AN005880L-02 100 µL

Nesfatin-1/Nucleobindin-2 Polyclonal Antibody

Sign In for Pricing
View Details