Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUBB4A protein

This Human TUBB4A protein spans the amino acid sequence from region 1-444aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tubulin 5 beta Tubulin beta-4 chain

UniProt

P04350

Expression Region

1-444aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LinkLabel™ Bluetooth Enabled Labeler
L3000 1 Each

LinkLabel™ Bluetooth Enabled Labeler

Sign In for Pricing
View Details
HNF1A-AS1 Human qPCR Primer Pair (NM_178513)
HP218843 200 Reactions

HNF1A-AS1 Human qPCR Primer Pair (NM_178513)

Sign In for Pricing
View Details
3-(3-Hydroxyphenyl)propionic Acid
TRC-H940090-25G 25 g

3-(3-Hydroxyphenyl)propionic Acid

Sign In for Pricing
View Details
Phalloidin, CF®647, 50 U
#00041-T 1x 50 U

Phalloidin, CF®647, 50 U

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), 0.2mg/mL
BNUB1526-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), 0.2mg/mL

Sign In for Pricing
View Details
Ultra Low Retention tip 96x2 BPIC-415
BPIC-415 1 Unit

Ultra Low Retention tip 96x2 BPIC-415

Sign In for Pricing
View Details