Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog CGRP protein

This Dog CGRP protein spans the amino acid sequence from region 85-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha type CGRP protein, Beta type CGRP protein, CALC 1 protein, CALC A protein, CALC1 protein, CALC2 protein, CALCA protein, CALCB protein, Calcitonin 1 protein, Calcitonin 2 protein, CGRP protein, CGRP-I protein, CGRP I protein, CGRP-II protein, CGRP II protein, CGRP 1 protein, CGRP-1 protein, CGRP1 protein, CGRP 2 protein, CGRP-2 protein, CGRP2 protein, Katacalcin protein

UniProt

P41547

Expression Region

85-116aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d9b 3'UTR GFP Stable Cell Line
TU170215 1.0 mL

Tbc1d9b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GRSF1 Rabbit mAb
E51A08627 100 µL

GRSF1 Rabbit mAb

Sign In for Pricing
View Details
PFAS siRNA (Mouse)
MBS827567-01 15 nmol

PFAS siRNA (Mouse)

Sign In for Pricing
View Details
PFAS siRNA (Mouse)
MBS827567-02 30 nmol

PFAS siRNA (Mouse)

Sign In for Pricing
View Details
PFAS siRNA (Mouse)
MBS827567-03 5x 30 nmol

PFAS siRNA (Mouse)

Sign In for Pricing
View Details
IcFSP1
HY-157068-01 1 mg

IcFSP1

Sign In for Pricing
View Details