Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACKR3 protein

This Human ACKR3 protein spans the amino acid sequence from region 1-40aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 7 Short name, CXC-R7 Short name, CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name, RDC-1

UniProt

P25106

Expression Region

1-40aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®790 Conjugate - Biotium Choice
P038-790-1ML 1x 1 mL

DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®790 Conjugate - Biotium Choice

Sign In for Pricing
View Details
1-(4-Amino-3,5-dichlorophenyl)-2-ethanone
TRC-A604690-500MG 500 mg

1-(4-Amino-3,5-dichlorophenyl)-2-ethanone

Sign In for Pricing
View Details
Mouse IgG3 (Immunoglobulin G3) ELISA Kit
E-EL-M2401-01 24 Tests

Mouse IgG3 (Immunoglobulin G3) ELISA Kit

Sign In for Pricing
View Details
Mouse IgG3 (Immunoglobulin G3) ELISA Kit
E-EL-M2401-02 48 Tests

Mouse IgG3 (Immunoglobulin G3) ELISA Kit

Sign In for Pricing
View Details
Mouse IgG3 (Immunoglobulin G3) ELISA Kit
E-EL-M2401-03 96 Tests

Mouse IgG3 (Immunoglobulin G3) ELISA Kit

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF568 conjugate, 0.1mg/mL
BNC681950-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details