Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACKR3 protein

This Human ACKR3 protein spans the amino acid sequence from region 1-40aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 7 Short name, CXC-R7 Short name, CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name, RDC-1

UniProt

P25106

Expression Region

1-40aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), Biotin conjugate, 0.1mg/mL
BNCB1917-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CX3CL1/Fractalkine Protein (His Tag)
PKSH032289-01 10 µg

Recombinant Human CX3CL1/Fractalkine Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CX3CL1/Fractalkine Protein (His Tag)
PKSH032289-02 50 µg

Recombinant Human CX3CL1/Fractalkine Protein (His Tag)

Sign In for Pricing
View Details
Human TNFRSF1B Antibody Pair Set
E-KAB-0226 50 µL & 100 µg

Human TNFRSF1B Antibody Pair Set

Sign In for Pricing
View Details
MYSM1 Antibody
8C17997-AAT 50 µg

MYSM1 Antibody

Sign In for Pricing
View Details
EGFR (GFR1195 + 31G7), Biotin conjugate, 0.1mg/mL
BNCB1200-500 1x 500 µL

EGFR (GFR1195 + 31G7), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details