Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACKR3 protein

This Human ACKR3 protein spans the amino acid sequence from region 1-40aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 7 Short name, CXC-R7 Short name, CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name, RDC-1

UniProt

P25106

Expression Region

1-40aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBP710
BA6769-1 1 mg

UBP710

Sign In for Pricing
View Details
Gsdma2 3'UTR Luciferase Stable Cell Line
TU109151 1.0 mL

Gsdma2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ABL1 antibody (Thr735)
70R-32627 0.1 mg

ABL1 antibody (Thr735)

Sign In for Pricing
View Details
Lentiviral mouse Rps6ka3 shRNA (UAS) - Lentiviral mouse Rps6ka3 shRNA (UAS, GFP) (100)
GTR15199209 1 Vial

Lentiviral mouse Rps6ka3 shRNA (UAS) - Lentiviral mouse Rps6ka3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-ELAVL2 HuB Antibody Picoband®, Dylight594 Conjugate
A06194-2-Dylight594 100 µg

Anti-ELAVL2 HuB Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
(Des-Gly10, D-Trp6, Pro-NHEt 9) -LHRH (sea bream)
FD109229-01 2000 µg

(Des-Gly10, D-Trp6, Pro-NHEt 9) -LHRH (sea bream)

Sign In for Pricing
View Details