Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Thrsp protein

This Mouse Thrsp protein spans the amino acid sequence from region 1-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Spot 14 protein Short name, S14 Short name, SPOT14

UniProt

Q62264

Expression Region

1-150aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGSF10 ORF Vector (Human) (pORF)
ORF005288 1.0 µg DNA

IGSF10 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FAM227A (NM_001013647) Human Over-expression Lysate
LS646851-100ug 100 µg

FAM227A (NM_001013647) Human Over-expression Lysate

Sign In for Pricing
View Details
Hsa-miR-4791 miRNA Inhibitor
orb1871811-01 10 nmol

Hsa-miR-4791 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4791 miRNA Inhibitor
orb1871811-02 20 nmol

Hsa-miR-4791 miRNA Inhibitor

Sign In for Pricing
View Details
Free Cholesterol (FC) Assay Kit
abx294080 96 Tests

Free Cholesterol (FC) Assay Kit

Sign In for Pricing
View Details
Recombinant Trichodesmium erythraeum Ribonuclease Z (rnz)
MBS1353596-01 0.02 mg (E-Coli)

Recombinant Trichodesmium erythraeum Ribonuclease Z (rnz)

Sign In for Pricing
View Details