Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scgb3a2 protein

This Mouse Scgb3a2 protein spans the amino acid sequence from region 22-139aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pneumo secretory protein 1 Short name, PnSP-1 Uteroglobin-related protein 1

UniProt

Q920H1

Expression Region

22-139aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRE Antibody
orb791292 2 mg

IRE Antibody

Sign In for Pricing
View Details
Anti-SMC4 Antibody Picoband® Fluoro488 Conjugated
A04887-1-Fluoro488 100 µg/Vial

Anti-SMC4 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Sodium M-tolylcarbamodithioate
DCA27868-01 100 mg

Sodium M-tolylcarbamodithioate

Sign In for Pricing
View Details
Sodium M-tolylcarbamodithioate
DCA27868-02 1 g

Sodium M-tolylcarbamodithioate

Sign In for Pricing
View Details
YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (MaxLight 750) discontinued
253500-ML750 100 µL

YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide (human)
4030658.1 1 mg

Gastric Inhibitory Polypeptide (human)

Sign In for Pricing
View Details