Animal IFN gamma protein
This Animal IFN gamma protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
IFG Protein, IFI Protein, IFN gamma Protein, IFN, immune Protein, IFN-gamma Protein, IFNG Protein, IFNG_HUMAN Protein, Immune interferon Protein, Interferon gamma Protein
UniProt
O35735
Expression Region
24-166aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Marmota monax (Woodchuck)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880270-500 1x 500 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880470-500 1x 500 µL
CD45 / LCA (2B11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942037-500 1x 500 µL
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740713-500 1x 500 µL
MyoD1 (5.8A + MYD712), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details