Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFN gamma protein

This Human IFN gamma protein spans the amino acid sequence from region 24-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFG Protein, IFI Protein, IFN gamma Protein, IFN, immune Protein, IFN-gamma Protein, IFNG Protein, IFNG_HUMAN Protein, Immune interferon Protein, Interferon gamma Protein

UniProt

P01579

Expression Region

24-161aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAGE7 (NM_021123) Human Recombinant Protein
TP304459M 100 µg

GAGE7 (NM_021123) Human Recombinant Protein

Sign In for Pricing
View Details
Human MEI4 activation kit by CRISPRa
GA119491 1 Kit

Human MEI4 activation kit by CRISPRa

Sign In for Pricing
View Details
Tnip3 Mouse Gene Knockout Kit (CRISPR)
KN518008 1 Kit

Tnip3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human RNASET2 Protein (Baculovirus, His Tag)
PKSH030611 50 µg

Recombinant Human RNASET2 Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD95/Fas Antibody[DX2]
E-AB-F1168G-01 20 Tests

PE/Cyanine5 Anti-Human CD95/Fas Antibody[DX2]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD95/Fas Antibody[DX2]
E-AB-F1168G-02 100 Tests

PE/Cyanine5 Anti-Human CD95/Fas Antibody[DX2]

Sign In for Pricing
View Details