Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFN gamma protein

This Human IFN gamma protein spans the amino acid sequence from region 24-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFG Protein, IFI Protein, IFN gamma Protein, IFN, immune Protein, IFN-gamma Protein, IFNG Protein, IFNG_HUMAN Protein, Immune interferon Protein, Interferon gamma Protein

UniProt

P01579

Expression Region

24-161aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD94 Antibody[DX22]
E-AB-F1384D-01 20 Tests

PE Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details
PE Anti-Human CD94 Antibody[DX22]
E-AB-F1384D-02 100 Tests

PE Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details
PE Anti-Human CD94 Antibody[DX22]
E-AB-F1384D-03 2x 100 Tests

PE Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details
(+)-Muscarine Chloride
TRC-M814003-5MG 5 mg

(+)-Muscarine Chloride

Sign In for Pricing
View Details
Leurosine Sulfate
TRC-L330800-5MG 5 mg

Leurosine Sulfate

Sign In for Pricing
View Details
CHTF8 (NM_001039690) Human Over-expression Lysate
LY421889 100 µg

CHTF8 (NM_001039690) Human Over-expression Lysate

Sign In for Pricing
View Details