Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sprr2a protein

This Mouse Sprr2a protein spans the amino acid sequence from region 1-83aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sprr2a1, Sprr2a, Small proline-rich protein 2A1, small proline-rich protein 2A

UniProt

Q9CQK8

Expression Region

1-83aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT1 Polyclonal Antibody
MBS2538810-01 0.02 mL

GIT1 Polyclonal Antibody

Sign In for Pricing
View Details
GIT1 Polyclonal Antibody
MBS2538810-02 0.06 mL

GIT1 Polyclonal Antibody

Sign In for Pricing
View Details
GIT1 Polyclonal Antibody
MBS2538810-03 0.12 mL

GIT1 Polyclonal Antibody

Sign In for Pricing
View Details
GIT1 Polyclonal Antibody
MBS2538810-04 0.2 mL

GIT1 Polyclonal Antibody

Sign In for Pricing
View Details
SRFBP1 Polyclonal Antibody
A72240-100 100 µL

SRFBP1 Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to p90RSK (Ab-348)
35-1483-50 50 μL

Polyclonal Antibody to p90RSK (Ab-348)

Sign In for Pricing
View Details