Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Envelope glycoprotein L protein

This Human Envelope glycoprotein L protein spans the amino acid sequence from region 23-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycoprotein 25 Short name, gp25

UniProt

P03212

Expression Region

23-137aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9,10-Dihydro-spiro[benzo[f]quinazoline-7 (2H),2'-[1,3]dithiolane]-1,3 (4H,8H) -dione
440503-01 2.5 mg

9,10-Dihydro-spiro[benzo[f]quinazoline-7 (2H),2'-[1,3]dithiolane]-1,3 (4H,8H) -dione

Sign In for Pricing
View Details
9,10-Dihydro-spiro[benzo[f]quinazoline-7 (2H),2'-[1,3]dithiolane]-1,3 (4H,8H) -dione
440503-02 25 mg

9,10-Dihydro-spiro[benzo[f]quinazoline-7 (2H),2'-[1,3]dithiolane]-1,3 (4H,8H) -dione

Sign In for Pricing
View Details
IRG1 siRNA (Human)
CRJ8756-01 15 nmol

IRG1 siRNA (Human)

Sign In for Pricing
View Details
IRG1 siRNA (Human)
CRJ8756-02 30 nmol

IRG1 siRNA (Human)

Sign In for Pricing
View Details
Lentiviral human ATF5 shRNA (UAS) - Lentiviral human ATF5 shRNA (UAS, GFP) (100)
GTR15132249 1 Vial

Lentiviral human ATF5 shRNA (UAS) - Lentiviral human ATF5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CCS Polyclonal Antibody
E-AB-65541-01 60 µL

CCS Polyclonal Antibody

Sign In for Pricing
View Details