Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Envelope glycoprotein L protein

This Human Envelope glycoprotein L protein spans the amino acid sequence from region 23-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycoprotein 25 Short name, gp25

UniProt

P03212

Expression Region

23-137aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,5-Dihydrofuran-2-Carboxylic Acid
RG-A263296-01 10 mg

2,5-Dihydrofuran-2-Carboxylic Acid

Sign In for Pricing
View Details
2,5-Dihydrofuran-2-Carboxylic Acid
RG-A263296-02 25 mg

2,5-Dihydrofuran-2-Carboxylic Acid

Sign In for Pricing
View Details
2,5-Dihydrofuran-2-Carboxylic Acid
RG-A263296-03 50 mg

2,5-Dihydrofuran-2-Carboxylic Acid

Sign In for Pricing
View Details
2,5-Dihydrofuran-2-Carboxylic Acid
RG-A263296-04 100 mg

2,5-Dihydrofuran-2-Carboxylic Acid

Sign In for Pricing
View Details
Thioflavin T
S6873-5g 5 g

Thioflavin T

Sign In for Pricing
View Details
SLC12A3 Rabbit Polyclonal Antibody (BF350)
orb2391080 100 µL

SLC12A3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details