Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli yihF protein

This E. coli yihF protein spans the amino acid sequence from region 25-476aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YihF, b3861, JW5574, Uncharacterized protein YihF

UniProt

P32128

Expression Region

25-476aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTQIQPGVEKFIKDFNDAKKKGEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITMLMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEYGKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQLSPMNKVTAKSFTIDSLARLEEKKFPVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGNQQLGSGEWSLIAESIDPSAVRQFIIQYNIAMQKQLAAHPELANDEVALQEVNAALFKEYLPLLQKSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVTETAKQLNLSEGMDAEKAQKQADKQISGMMTLGQMFQLITIDNNTASLQLRYTPGKVVFNGQEMSEEEFMSRAGRFVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[[2-[ (2-Methylphenyl) methyl]-3-sulfanylpropanoyl]amino]-4-methylsulfanylbutanoic acid
VFA77514 1 mg

2-[[2-[ (2-Methylphenyl) methyl]-3-sulfanylpropanoyl]amino]-4-methylsulfanylbutanoic acid

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)
MBS2165920-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)
MBS2165920-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)
MBS2165920-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)
MBS2165920-04 1 mL

Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)
MBS2165920-05 5 mL

Cy3-Linked Monoclonal Antibody to Endothelial Cell Adhesion Molecule (ESAM)

Sign In for Pricing
View Details