Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Parvalbumin beta protein

This Fish Parvalbumin beta protein spans the amino acid sequence from region 2-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, Gad m 1

UniProt

Q90YK9

Expression Region

2-109aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Gadus morhua (Atlantic cod)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dync1i2 shRNA (UAS) - Lentiviral mouse Dync1i2 shRNA (UAS, RFP) (100)
GTR15300183 1 Vial

Lentiviral mouse Dync1i2 shRNA (UAS) - Lentiviral mouse Dync1i2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MLX Rabbit Polyclonal Antibody (Biotin)
orb2126467 100 µL

MLX Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PAWP shRNA (m) Lentiviral Particles
sc-152039-V 200 µL

PAWP shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
SLC26A6 (Solute Carrier Family 26 Member 6)
491997 100 µL

SLC26A6 (Solute Carrier Family 26 Member 6)

Sign In for Pricing
View Details
Mouse IKZF4 siRNA
abx920383-01 15 nmol

Mouse IKZF4 siRNA

Sign In for Pricing
View Details
Mouse IKZF4 siRNA
abx920383-02 30 nmol

Mouse IKZF4 siRNA

Sign In for Pricing
View Details