Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat PHLPII protein

This Rat PHLPII protein spans the amino acid sequence from region 27-122aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p II Allergen, Phl p 2

UniProt

P43214

Expression Region

27-122aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
E12009m 96 Tests

ELISA Kit For Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A

Sign In for Pricing
View Details
Purified Exosomes: Mouse Serum (Pooled)
EXOP-560M-1 ≥ 25 µg

Purified Exosomes: Mouse Serum (Pooled)

Sign In for Pricing
View Details
Methyl Iodoacetate
455929-01 1 g

Methyl Iodoacetate

Sign In for Pricing
View Details
Methyl Iodoacetate
455929-02 10 g

Methyl Iodoacetate

Sign In for Pricing
View Details
Recombinant Human ADAMTS8 Protein, N-His
YHJ82701 100 μg

Recombinant Human ADAMTS8 Protein, N-His

Sign In for Pricing
View Details
Mouse recombinant IL-21 Protein
PROTQ9ES17-2-250ug 250 µg

Mouse recombinant IL-21 Protein

Sign In for Pricing
View Details