Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat PHLPII protein

This Rat PHLPII protein spans the amino acid sequence from region 27-122aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p II Allergen, Phl p 2

UniProt

P43214

Expression Region

27-122aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDH sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46445111 3x 1.0 µg

TDH sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CD36 Mouse
OM300729-01 10 µg

CD36 Mouse

Sign In for Pricing
View Details
CD36 Mouse
OM300729-02 2 µg

CD36 Mouse

Sign In for Pricing
View Details
CD36 Mouse
OM300729-03 1 mg

CD36 Mouse

Sign In for Pricing
View Details
TFB2M (NM_022366) Human Tagged Lenti ORF Clone
RC201683L1 10 µg

TFB2M (NM_022366) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gbp6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3642107 1.0 µg DNA

Gbp6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details